Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | ...The purity of synthesized peptides was 95%, verified by mass spectrometry and high-performance liquid chromatography (HPLC) (GenScript). Peptide sequences are as follows: TAT-BH4 Bcl-2 peptide, NH2-GRKKRRQRRRGGRTGYDNREIVMKYIHYKLSQRGYEW-COOH; TAT-ctrl, NH2-RKKRRQRRRGGLKNDDICLRVYTPVSILVNE-COOH... | Get A Quote |
Although the presence of a BH4 domain distinguishes the antiapoptotic protein Bcl-2 from its proapoptotic relatives, little is known about its function. BH4 deletion converts Bcl-2 into a proapoptotic protein, whereas a TAT-BH4 fusion peptide inhibits apoptosis and improves survival in models of disease due to accelerated apoptosis. Thus, the BH4 domain has antiapoptotic activity independent of full-length Bcl-2. Here we report that the BH4 domain mediates interaction of Bcl-2 with the inositol 1,4,5-trisphosphate (IP3) receptor, an IP3-gated Ca(2+) channel on the endoplasmic reticulum (ER). BH4 peptide binds to the regulatory and coupling domain of the IP3 receptor and inhibits IP3-dependent channel opening, C... More