| Products/Services Used | Details | Operation |
|---|---|---|
| Gene Synthesis> | La secuencia del péptido molde, cecropina-D (Neutro), fue tomada de Cytryńska y colaboradores (Cytryńska et al., 2007). Esta secuencia consta de 39 residuos (ENFFKEIERAGQRIRDAIISAAPAVETLAQAQKIIKGGD) y tiene una carga igual a 0 a pH fisiológico. La secuencia molde se utilizó para generar los péptidos análogos +5 (ENFFKRIRRAGKRIRDAIISAAPAVETLAQAQKIIKGGD) y +9 (RNFFKRIRRAGKRIRKAIISAAPAVETLAQAQKIIKGGD). Para el péptido +5 se realizaron los cambios de E6R, E8R y Q12K. Para el péptido +9 se realizaron las mismas sustituciones mencionadas previamente, más los cambios de E1R, y D16K. Las cargas de los tres péptidos se calcularon con algoritmo de GenScript Corporation, Piscataway, NJ, USA; Web: www. genscript.com. | Get A Quote |
Antimicrobial peptides (PAMs) play an important role in the innate defense systems of most organisms; they act against bacteria, fungi, viruses and parasites. The mechanism of action of cationic PAMs rely on their capacity to interact with the anionic microbial membrane surface. The cecropin family was identified as one of the most important peptides in insects. Such peptides do not contain cysteine residues and are classified as α-helical. To study the effect of the charge on the peptide structure, we introduced positive charge residues in the last 18 residues at the N-end of cecropin-D (WT) and evaluated the biological activity of the modified peptides. Two analogous peptides from cecropin-D were obtained by... More