| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | Competition with BG505 V3-peptide (TRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAH, GenScript) was performed by pre-incubation of antibodies or plasmas with 150 mg/mL V3-peptide at room temperature for 1 hr before incubation on BG505 SOSIP.... Biotinylated BG505 V3-peptide (TRPNNNTRKSIRIGPG QAFYATGDIIGDIRQAH, GenScript) was captured on the neutravidin plate for 2 hr at RT, before adding serial dilutions of Fab or plasma for additional 2 hr at RT. | Get A Quote |
Characterizing polyclonal antibody responses via currently available methods is inherently complex and difficult. Mapping epitopes in an immune response is typically incomplete, which creates a barrier to fully understanding the humoral response to antigens and hinders rational vaccine design efforts. Here, we describe a method of characterizing polyclonal responses by using electron microscopy, and we applied this method to the immunization of rabbits with an HIV-1 envelope glycoprotein vaccine candidate, BG505 SOSIP.664. We detected known epitopes within the polyclonal sera and revealed how antibody responses evolved during the prime-boosting strategy to ultimately result in a neutralizing antibody response. ... More