| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | The LL-37 peptide (amino acid sequence: [LL-37, 37 aa]) was synthesised by GenScript (Piscataway, NJ, USA). | Get A Quote |
Antimicrobial peptides are widespread in nature and are produced by many organisms as a first line of defence against pathogens. These peptides have a broad range of biological activities, such as antibacterial or antifungal activities and act with varied mechanisms of action. A large number of the peptides are amphipathic α-helices which act by disrupting plasma membranes and allowing leakage of intracellular contents. However, some peptides have more complex mechanisms of action that require internalisation into the target organisms' cytoplasm. The method by which these peptides enter the cytoplasm varies, with some requiring the energy dependent processes of endocytosis or polyamine transport and othe... More