5-FAM-β-Amyloid (1-40)

This is a fluorescent 5-FAM-labeled β-Amyloid (1-40), Abs/Em=492/518 nm. FAM is preferred over FITC because of its photo- and chemical stability.

Description	This is a fluorescent 5-FAM-labeled β-Amyloid (1-40), Abs/Em=492/518 nm. FAM is preferred over FITC because of its photo- and chemical stability.
Sequence	{Asp}{Ala}{Glu}{Phe}{Arg}{His}{Asp}{Ser}{Gly}{Tyr}{Glu}{Val} {His}{His}{Gln}{Lys}{Leu}{Val}{Phe}{Phe}{Ala}{Glu}{Asp}{Val} {Gly}{Ser}{Asn}{Lys}{Gly}{Ala}{Ile}{Ile}{Gly}{Leu}{Met}{Val} {Gly}{Gly}{Val}{Val}
Sequence Shortening	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
N Terminal	5-FAM
Molecular Weight	4688.13

Purity	>95%
Solubility	Can be dissolved in 3% ammonia water.
Form	Lyophilized
Storage	Store at -20°C. Keep tightly closed. Store in a cool dry place.

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.