Description | This pool includes 53 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Membrane protein (Protein ID: P0DTC5) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays. |
Sequence |
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPV TLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILL NVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYK LGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ |
Purity | Crude |
Solubility | Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
Form | Lyophilized |
Storage | Store at -20°C. |
Note | The peptides of this product are supplied as trifluoroacetate salts |
T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response |
Please note that we do not provide HPLC and MS reports for each individual peptide within our peptide library products.