Description | Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties. |
Cas No | 148498-78-6 |
Sequence |
{TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}{LEU}{ARG} {SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN} {LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS} {ASP}{LYS}{ASP}{ASN}{VAL}{ALA}{PRO}{ARG}{SER}{LYS}{ILE}{SER} {PRO}{GLN}{GLY}{TYR} |
Sequence Shortening | YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY |
Molecular Formula | C264H406N80O77S3 |
C Terminal | Amidation |
Disulfide Bridge | 16-21 |
Molecular Weight | 6028.9 |
Purity | > 95% |
Solubility | Soluble in Ultrapure water under 1mg/ml |
Form | Lyophilized |
Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
Note | The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease. |