| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | … Cathepsins B and L. Synthetic KYHLRFSYTRRNYMWTQTGSFFLKETEGWHTT SLFPLFPNPGPR peptide (HPLC purity 98%), comprising residues 151–194 of human ABCA3, was purchased from GenScript (Piscataway, USA) … | Get A Quote |
background: ABCA3 is a lipid transporter in the limiting membrane of lamellar bodies in alveolar type II cells. Mutations in the ABCA3 gene cause respiratory distress syndrome in new-borns and childhood interstitial lung disease. ABCA3 is N-terminally cleaved by an as yet unknown protease, a process believed to regulate ABCA3 activity. methods: The exact site where ABCA3 is cleaved was localized using mass spectrometry (MS). Proteases involved in ABCA3 processing were identified using small molecule inhibitors and siRNA mediated gene knockdown. Results were verified by in vitro digestion of a synthetic peptide substrate mimicking ABCA3's cleavage region, followed by MS analysis. results: We found that cleavage ... More