| Products/Services Used | Details | Operation |
|---|---|---|
| Neuropeptide Y(1-36)> | ...Panning was performed in solution with biotinylated human AT I (sequence: DRVYIHPFHL) and biotinylated human NPY (sequence: YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY) (<b>GenScript</b>, Piscataway, NJ) ... | Get A Quote |
SummarySome species mount a robust antibody response despite having limited genome-encoded combinatorial diversity potential. Cows are unusual in having exceptionally long CDR H3 loops and few V regions, but the mechanism for creating diversity is not understood. Deep sequencing reveals that ultralong CDR H3s contain a remarkable complexity of cysteines, suggesting that disulfide-bonded minidomains may arise during repertoire development. Indeed, crystal structures of two cow antibodies reveal that these CDR H3s form a very unusual architecture composed of a β strand “stalk” that supports a structurally diverse, disulfide-bonded “knob” domain. Diversity arises from somatic hypermuta... More