| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | BG505-derived peptides with the following sequences were purchased from Genscript (Piscataway, NJ): V1: TNVTNNITDDMRGELKN; V2 (5 overlapping peptides): MTTELRDKKQKVYSL, DKKQKVYSLFYRLDV, YSLFYRLDVVQINEN, LDVVQINENQGNRSN, ENQGNRSNNSNKEYR; V3: TRPNNNTRKSIRIGPGQAFYATGDIIGDIRQAH; C1-V1: VKLTPLCVTLQCTNVTNNITDDMRGELKN. | Get A Quote |
A challenge for HIV-1 immunogen design is the difficulty of inducing neutralizing antibodies (NAbs) against neutralization-resistant (tier 2) viruses that dominate human transmissions. We show that a soluble recombinant HIV-1 envelope glycoprotein trimer that adopts a native conformation, BG505 SOSIP.664, induced NAbs potently against the sequence-matched tier 2 virus in rabbits and similar but weaker responses in macaques. The trimer also consistently induced cross-reactive NAbs against more sensitive (tier 1) viruses. Tier 2 NAbs recognized conformational epitopes that differed between animals and in some cases overlapped with those recognized by broadly neutralizing antibodies (bNAbs), whereas tier 1 respons... More