| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | albicans– derived peptide Ece1-III K 62-92K (SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK), designated here as candidalysin, was synthesized by GenScript (Lot No:16017867190002/PE2773, Purity 98. | Get A Quote |
Candida albicans infection can cause skin, vulvar, or oral pain. Despite the obvious algesic activity of C. albicans, the molecular mechanisms of fungal nociception remain largely unknown. Here we show that the C. albicans-specific signaling pathway led to severe mechanical allodynia. We discovered that C. albicans-derived β-glucan stimulated nociceptors depending on Dectin-1, and two pathways in inflammatory pain. The major pathway operates via the Dectin-1-mediated ATP-P2X3/P2X2/3 axis through intercellular relationships between keratinocytes and primary sensory neurons, which depends on the ATP transporter vesicular nucleotide transporter (VNUT). The other pathway operates via the Dectin-1-mediated PLC-TRPV... More