| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | Antibodies against PfSPC25 were generated in rabbits (GenScript) against peptide 1-MSGNNVQEEDSTFHVSNLYSETEIKKITQDFISEKIREQNFEEI-44.... 2014 ) Rabbit anti-SPC25 antibodies were raised in this study were generated by GenScript against the peptide 1- MSGNNVQEEDSTFHVSNLYSETEIKKITQDFISEKIREQNFEEI-44. | Get A Quote |
Plasmodium falciparum exports hundreds of virulence proteins within infected erythrocytes, a process that requires cleavage of a pentameric motif called Plasmodium export element or vacuolar transport signal by the endoplasmic reticulum (ER)-resident protease plasmepsin V. We identified plasmepsin V-binding proteins that form a unique interactome required for the translocation of effector cargo into the parasite ER. These interactions are functionally distinct from the Sec61-signal peptidase complex required for the translocation of proteins destined for the classical secretory pathway. This interactome does not involve the signal peptidase (SPC21) and consists of PfSec61, PfSPC25, plasmepsin V and PfSec62, whi... More