| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | For priming, 12- to 20-week-old female ABabDII mice3 were injected subcutaneously with 150 µg of MAGE-A1 long peptide (YEFLWGPRALAETSYVKVLEYVIKVSARVR, Genscript) in a 200 µl 1:1 solution of incomplete Freund’s adjuvant and PBS supplemented with 50 µg CpG.... Successive boosts were performed with 100 µg of MAGE-A1278 peptide (Genscript) including the same adjuvants. | Get A Quote |
Identifying T-cell receptors (TCRs) that bind tumor-associated antigens (TAAs) with optimal affinity is a key bottleneck in the development of adoptive T-cell therapy of cancer. TAAs are unmutated self proteins, and T cells bearing high-affinity TCRs specific for such antigens are commonly deleted in the thymus. To identify optimal-affinity TCRs, we generated antigen-negative humanized mice with a diverse human TCR repertoire restricted to the human leukocyte antigen (HLA) A*02:01 (ref. 3). These mice were immunized with human TAAs, for which they are not tolerant, allowing induction of CD8⁺ T cells with optimal-affinity TCRs. We isolate TCRs specific for the cancer/testis (CT) antigen MAGE-A1 (ref. 4) and sh... More