Products/Services Used | Details | Operation |
---|---|---|
Peptide Synthesis> | The V3 peptide (TRPNNNTRKSIRIGPGQTFYATGDIIGNIRQAY) based on the 16055 V3 sequence was synthesized by Genscript. | Get A Quote |
Advances in HIV-1 envelope glycoprotein (Env) design generate native-like trimers and high-resolution clade A, B, and G structures and elicit neutralizing antibodies. However, a high-resolution clade C structure is critical, as this subtype accounts for the majority of HIV infections worldwide, but well-ordered clade C Env trimers are more challenging to produce due to their instability. Based on targeted glycine substitutions in the Env fusion machinery, we defined a general approach that disfavors helical transitions leading to post-fusion conformations, thereby favoring the pre-fusion state. We generated a stabilized, soluble clade C Env (16055 NFL) and determined its crystal structure at 3.... More