| Products/Services Used | Details | Operation |
|---|---|---|
| Peptide Synthesis> | (SAWSHPQFEKGGGSGGGSGGSAWSHPQFEKG), custom synthesized (GenScript) with flanking NotI/HindIII sites | Get A Quote |
Owing to their high affinities and specificities, rabbit monoclonal antibodies (mAbs) have demonstrated value and potential primarily as basic research and diagnostic reagents, but, in some cases, also as therapeutics. To accelerate access to rabbit mAbs bypassing immunization, we generated a large na?ve rabbit antibody repertoire represented by a phage display library encompassing >10 billion independent antibodies in chimeric rabbit/human Fab format and validated it by next-generation sequencing. Panels of rabbit mAbs selected from this library against two emerging cancer targets, ROR1 and ROR2, revealed high diversity, affinity, and specificity. Moreover, ROR1- and ROR2-targeting rabbit m... More