Products/Services Used | Details | Operation |
---|---|---|
Proteins, Expression, Isolation and Analysis> | … weighed and ICV injected with either saline alone (control group) or containing 25 ng/g of goldfish nesfatin-1 (VPISIDKTKVKLPEETVKESPQNVDTGLHYDRYLREVIDFLEKDQHFREKLHNTD MEDIKQGKLAKELDFVSHHVRTK LDEL; GenScript, Piscataway, USA; experimental … | Get A Quote |
Nesfatin-1 is an 82 amino acid peptide that has been involved in a wide variety of physiological functions in both mammals and fish. This study aimed to elucidate the role of nesfatin-1 on rainbow trout food intake, and its putative effects on glucose and fatty acid sensing systems. Intracerebroventricular administration of 25 ng/g nesfatin-1 resulted in a significant inhibition of appetite, likely mediated by the activation of central POMC and CART. Nesfatin-1 stimulated the glucosensing machinery (changes in , and mRNA expression) in the hindbrain and hypothalamus. Central fatty acid sensing mechanisms were unaltered by nesfatin-1, but this peptide altered the expression of mRNAs encoding factors reg... More