| Description | This pool includes 22 peptides derived from a peptide scan (15mers with 11 aa overlap) through the entire Protein 9b (Protein ID: P0DTD2) of SARS-CoV-2 (Severe Acute Respiratory Syndrome-related coronavirus 2) for T cell assays. |
| Sequence |
MDPKISEMHPALRLVDPQIQLAVTRMENAVGRDQNNVGPKVYPIILRLGSPLSLNMARKT LNSLEDKAFQLTPIAVQMTKLATTEELPDEFVVVTVK |
| Purity | Crude |
| Solubility | Dissolve in a minimum amount of pure DMSO (approx. 40 µl) and dilute with PBS buffer to the final concentration. Please note that the final concentration of DMSO must be below 1 % (v/v) to avoid toxicity in the biological system. |
| Form | Lyophilized |
| Storage | Store at -20°C. |
| 注意 | The peptides of this product are supplied as trifluoroacetate salts |
| T-cell assays, Immune monitoring, Antigen specific T-cell stimulation, T-cell expansion, Cellular immune response |