LL-37, scrambled
The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version.
| ￥1700 | |
| RP20332 | |
|
|
|
|
|
|
|
|
|
| ￥1700 | |
| RP20332 | |
|
|
|
|
|
|
|
|
|
| Description | The cathelicidin anti-microbial peptide LL-37 corresponds to aa 134-170 of the human cationic antimicrobial protein 18 (hCAP18). This peptide is the scrambled version. |
| Sequence |
{Gly}{Leu}{Lys}{Leu}{Arg}{Phe}{Glu}{Phe}{Ser}{Lys}{Ile}{Lys} {Gly}{Glu}{Phe}{Leu}{Lys}{Thr}{Pro}{Glu}{Val}{Arg}{Phe}{Arg} {Asp}{Ile}{Lys}{Leu}{Lys}{Asp}{Asn}{Arg}{Ile}{Ser}{Val}{Gln} {Arg} |
| Sequence Shortening | GLKLRFEFSKIKGEFLKTPEVRFRDIKLKDNRISVQR |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493.3 |
| Purity | >95% |
| Solubility | Soluble in Ultrapure water under 1mg/ml |
| Form | Lyophilized |
| Storage | Store at -20°C. |
