Description | The cathelicidin anti-microbial peptide LL-37 is involved in the reepithelialization of human skin wounds and is lacking in chronic ulcer epithelium. LL-37(human) is a cathelicidin-derived peptide with antimicrobial and angiogenic activity. |
Sequence |
{LEU}{LEU}{GLY}{ASP}{PHE}{PHE}{ARG}{LYS}{SER}{LYS}{GLU}{LYS} {ILE}{GLY}{LYS}{GLU}{PHE}{LYS}{ARG}{ILE}{VAL}{GLN}{ARG}{ILE} {LYS}{ASP}{PHE}{LEU}{ARG}{ASN}{LEU}{VAL}{PRO}{ARG}{THR}{GLU} {SER} |
Sequence Shortening | [LL-37, 37 aa] |
Molecular Formula | C205H340N60O53 |
Molecular Weight | 4493.28 |
Purity | > 95% |
Solubility | Soluble in Ultrapure water under 1mg/ml |
Form | Lyophilized |
Storage | Store the product at -20°C. Keep container tightly closed. Store in a cool dry place. |