| ￥700 | |
| RP10492 | |
|
|
|
|
|
|
|
|
|
| Synonyms | NPY |
| Description | Neuropeptide Y (NPY) is a vasoconstrictor and a brain peptide that inhibits Ca2+-activated K+ channels in vascular smooth muscle. Neuropeptide Y (NPY) is implicated in the control of blood pressure, sexual behavior, and food intake. Neuropeptide Y (NPY) inhibits cholecystokinin- and secretin-stimulated pancreatic secretion. |
| Cas No | 90880-35-6 |
| Sequence |
{TYR}{PRO}{SER}{LYS}{PRO}{ASP}{ASN}{PRO}{GLY}{GLU}{ASP}{ALA} {PRO}{ALA}{GLU}{ASP}{MET}{ALA}{ARG}{TYR}{TYR}{SER}{ALA}{LEU} {ARG}{HIS}{TYR}{ILE}{ASN}{LEU}{ILE}{THR}{ARG}{GLN}{ARG}{TYR} |
| Sequence Shortening | YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY |
| Molecular Formula | C189H285N55O57S1 |
| C Terminal | Amidation |
| Molecular Weight | 4271.68 |
| Purity | > 95% |
| Solubility | Soluble in Ultrapure water under 1mg/ml |
| Form | Lyophilized |
| Storage | Store at -20°C. |
»
